Lineage for d6nfha_ (6nfh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983389Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)
  8. 2983553Domain d6nfha_: 6nfh A: [366212]
    automated match to d5p9ia_
    complexed with edo, klm

Details for d6nfha_

PDB Entry: 6nfh (more details), 1.4 Å

PDB Description: btk in complex with inhibitor 8-(2,3-dihydro-1h-inden-5-yl)-2-({4- [(2s)-3-(dimethylamino)-2-hydroxypropoxy]phenyl}amino)-5,8- dihydropteridine-6,7-dione
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d6nfha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nfha_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
imyscwhekaderptfkillsnildvmdees

SCOPe Domain Coordinates for d6nfha_:

Click to download the PDB-style file with coordinates for d6nfha_.
(The format of our PDB-style files is described here.)

Timeline for d6nfha_: