Lineage for d6nmfp_ (6nmf P:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579677Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2579678Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 2579679Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 2579692Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 2579693Species Cow (Bos taurus) [TaxId:9913] [81444] (47 PDB entries)
  8. 3066147Domain d6nmfp_: 6nmf P: [366209]
    Other proteins in same PDB: d6nmfa_, d6nmfb1, d6nmfb2, d6nmfd_, d6nmfe_, d6nmff_, d6nmfg_, d6nmfh_, d6nmfi_, d6nmfj_, d6nmfk_, d6nmfl_, d6nmfm_, d6nmfn_, d6nmfo1, d6nmfo2, d6nmfq_, d6nmfr_, d6nmfs_, d6nmft_, d6nmfu_, d6nmfv_, d6nmfw_, d6nmfx_, d6nmfy_, d6nmfz_
    automated match to d1v54c_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d6nmfp_

PDB Entry: 6nmf (more details), 2.8 Å

PDB Description: sfx structure of reduced cytochrome c oxidase at room temperature
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d6nmfp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nmfp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d6nmfp_:

Click to download the PDB-style file with coordinates for d6nmfp_.
(The format of our PDB-style files is described here.)

Timeline for d6nmfp_:

  • d6nmfp_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-16