Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) automatically mapped to Pfam PF05392 |
Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins) |
Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81420] (33 PDB entries) |
Domain d6nmfx_: 6nmf X: [366205] Other proteins in same PDB: d6nmfa_, d6nmfb1, d6nmfb2, d6nmfc_, d6nmfd_, d6nmfe_, d6nmff_, d6nmfg_, d6nmfh_, d6nmfi_, d6nmfj_, d6nmfl_, d6nmfm_, d6nmfn_, d6nmfo1, d6nmfo2, d6nmfp_, d6nmfq_, d6nmfr_, d6nmfs_, d6nmft_, d6nmfu_, d6nmfv_, d6nmfw_, d6nmfy_, d6nmfz_ automated match to d1v54k_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 6nmf (more details), 2.8 Å
SCOPe Domain Sequences for d6nmfx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nmfx_ f.23.5.1 (X:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]} apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
Timeline for d6nmfx_:
View in 3D Domains from other chains: (mouse over for more information) d6nmfa_, d6nmfb1, d6nmfb2, d6nmfc_, d6nmfd_, d6nmfe_, d6nmff_, d6nmfg_, d6nmfh_, d6nmfi_, d6nmfj_, d6nmfk_, d6nmfl_, d6nmfm_, d6nmfn_, d6nmfo1, d6nmfo2, d6nmfp_, d6nmfq_, d6nmfr_, d6nmfs_, d6nmft_, d6nmfu_, d6nmfv_, d6nmfw_, d6nmfy_, d6nmfz_ |