SCOPe 2.07: Domain d6nmpy_: 6nmp Y:

Lineage for d6nmpy_ (6nmp Y:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family)
   automatically mapped to Pfam PF02935

5. Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81424] (49 PDB entries)

8. Domain d6nmpy_: 6nmp Y: [366197]
   Other proteins in same PDB: d6nmpa_, d6nmpb1, d6nmpb2, d6nmpc_, d6nmpd_, d6nmpe_, d6nmpf_, d6nmpg_, d6nmph_, d6nmpi_, d6nmpj_, d6nmpk_, d6nmpm_, d6nmpn_, d6nmpo1, d6nmpo2, d6nmpp_, d6nmpq_, d6nmpr_, d6nmps_, d6nmpt_, d6nmpu_, d6nmpv_, d6nmpw_, d6nmpx_, d6nmpz_
   automated match to d1v54l_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d6nmpy_

PDB Entry: 6nmp, 2.9 Å

PDB Description: sfx structure of oxidized cytochrome c oxidase at room temperature

PDB Compounds: (Y:) cytochrome c oxidase subunit 7c, mitochondrial

SCOPe Domain Sequences for d6nmpy_:

Sequence; same for both SEQRES and ATOM records:

>d6nmpy_ f.23.6.1 (Y:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

Timeline for d6nmpy_:

• d6nmpy_ is new in SCOPe 2.07-stable
  
• d6nmpy_ appears in the current release, SCOPe 2.08