Lineage for d6nmfu_ (6nmf U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327889Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327890Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2327891Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2327892Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2327893Species Cow (Bos taurus) [TaxId:9913] [47697] (29 PDB entries)
  8. 2327943Domain d6nmfu_: 6nmf U: [366167]
    Other proteins in same PDB: d6nmfa_, d6nmfb1, d6nmfb2, d6nmfc_, d6nmfd_, d6nmfe_, d6nmff_, d6nmfg_, d6nmfi_, d6nmfj_, d6nmfk_, d6nmfl_, d6nmfm_, d6nmfn_, d6nmfo1, d6nmfo2, d6nmfp_, d6nmfq_, d6nmfr_, d6nmfs_, d6nmft_, d6nmfv_, d6nmfw_, d6nmfx_, d6nmfy_, d6nmfz_
    automated match to d1v54h_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d6nmfu_

PDB Entry: 6nmf (more details), 2.8 Å

PDB Description: sfx structure of reduced cytochrome c oxidase at room temperature
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d6nmfu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nmfu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d6nmfu_:

Click to download the PDB-style file with coordinates for d6nmfu_.
(The format of our PDB-style files is described here.)

Timeline for d6nmfu_: