Lineage for d6nmfo2 (6nmf O:91-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771045Species Cow (Bos taurus) [TaxId:9913] [49545] (50 PDB entries)
  8. 2771135Domain d6nmfo2: 6nmf O:91-227 [366146]
    Other proteins in same PDB: d6nmfa_, d6nmfb1, d6nmfc_, d6nmfd_, d6nmfe_, d6nmff_, d6nmfg_, d6nmfh_, d6nmfi_, d6nmfj_, d6nmfk_, d6nmfl_, d6nmfm_, d6nmfn_, d6nmfo1, d6nmfp_, d6nmfq_, d6nmfr_, d6nmfs_, d6nmft_, d6nmfu_, d6nmfv_, d6nmfw_, d6nmfx_, d6nmfy_, d6nmfz_
    automated match to d1v54b1
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d6nmfo2

PDB Entry: 6nmf (more details), 2.8 Å

PDB Description: sfx structure of reduced cytochrome c oxidase at room temperature
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6nmfo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nmfo2 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d6nmfo2:

Click to download the PDB-style file with coordinates for d6nmfo2.
(The format of our PDB-style files is described here.)

Timeline for d6nmfo2: