Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries) |
Domain d6nmfo1: 6nmf O:1-90 [366145] Other proteins in same PDB: d6nmfa_, d6nmfb2, d6nmfc_, d6nmfd_, d6nmfe_, d6nmff_, d6nmfg_, d6nmfh_, d6nmfi_, d6nmfj_, d6nmfk_, d6nmfl_, d6nmfm_, d6nmfn_, d6nmfo2, d6nmfp_, d6nmfq_, d6nmfr_, d6nmfs_, d6nmft_, d6nmfu_, d6nmfv_, d6nmfw_, d6nmfx_, d6nmfy_, d6nmfz_ automated match to d1v54b2 complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 6nmf (more details), 2.8 Å
SCOPe Domain Sequences for d6nmfo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nmfo1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d6nmfo1:
View in 3D Domains from other chains: (mouse over for more information) d6nmfa_, d6nmfb1, d6nmfb2, d6nmfc_, d6nmfd_, d6nmfe_, d6nmff_, d6nmfg_, d6nmfh_, d6nmfi_, d6nmfj_, d6nmfk_, d6nmfl_, d6nmfm_, d6nmfn_, d6nmfp_, d6nmfq_, d6nmfr_, d6nmfs_, d6nmft_, d6nmfu_, d6nmfv_, d6nmfw_, d6nmfx_, d6nmfy_, d6nmfz_ |