Lineage for d1f6sc_ (1f6s C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76074Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 76075Protein alpha-Lactalbumin [53975] (5 species)
  7. 76078Species Cow (Bos taurus) [TaxId:9913] [53980] (3 PDB entries)
  8. 76087Domain d1f6sc_: 1f6s C: [36614]

Details for d1f6sc_

PDB Entry: 1f6s (more details), 2.2 Å

PDB Description: crystal structure of bovine alpha-lactalbumin

SCOP Domain Sequences for d1f6sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6sc_ d.2.1.2 (C:) alpha-Lactalbumin {Cow (Bos taurus)}
eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw
ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc
ek

SCOP Domain Coordinates for d1f6sc_:

Click to download the PDB-style file with coordinates for d1f6sc_.
(The format of our PDB-style files is described here.)

Timeline for d1f6sc_: