Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
Species Goat (Capra hircus) [TaxId:9925] [53979] (5 PDB entries) |
Domain d1fkqa1: 1fkq A:1-123 [36601] Other proteins in same PDB: d1fkqa2 complexed with ca |
PDB Entry: 1fkq (more details), 1.8 Å
SCOPe Domain Sequences for d1fkqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fkqa1 d.2.1.2 (A:1-123) alpha-Lactalbumin {Goat (Capra hircus) [TaxId: 9925]} eqltkcevfqklkdlkdyggvslpewvcvafhtsgydtqaivqnndsteyglfqinnkiw ckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwlc ekl
Timeline for d1fkqa1: