Lineage for d1fkqa1 (1fkq A:1-123)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924220Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 2924239Species Goat (Capra hircus) [TaxId:9925] [53979] (5 PDB entries)
  8. 2924242Domain d1fkqa1: 1fkq A:1-123 [36601]
    Other proteins in same PDB: d1fkqa2
    complexed with ca

Details for d1fkqa1

PDB Entry: 1fkq (more details), 1.8 Å

PDB Description: recombinant goat alpha-lactalbumin t29v
PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1fkqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkqa1 d.2.1.2 (A:1-123) alpha-Lactalbumin {Goat (Capra hircus) [TaxId: 9925]}
eqltkcevfqklkdlkdyggvslpewvcvafhtsgydtqaivqnndsteyglfqinnkiw
ckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwlc
ekl

SCOPe Domain Coordinates for d1fkqa1:

Click to download the PDB-style file with coordinates for d1fkqa1.
(The format of our PDB-style files is described here.)

Timeline for d1fkqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fkqa2