SCOPe 2.08: Domain d6iczv_: 6icz v:

Lineage for d6iczv_ (6icz v:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.232: Mago nashi protein [89816] (1 superfamily)
   beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234

4. Superfamily d.232.1: Mago nashi protein [89817] (1 family)
   automatically mapped to Pfam PF02792

5. Family d.232.1.1: Mago nashi protein [89818] (2 proteins)

6. Protein automated matches [365972] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [365973] (1 PDB entry)

8. Domain d6iczv_: 6icz v: [365974]
   Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczy_
   automated match to d2hyia_
   complexed with atp, gtp, ihp, mg, zn

Details for d6iczv_

PDB Entry: 6icz, 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom

PDB Compounds: (v:) Protein mago nashi homolog 2

SCOPe Domain Sequences for d6iczv_:

Sequence; same for both SEQRES and ATOM records:

>d6iczv_ d.232.1.1 (v:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkr
iiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvf
yylvqdlkclvfsliglhfkikpi

Timeline for d6iczv_:

• d6iczv_ first appeared in SCOPe 2.07