SCOP 1.71: Domain d1b9oa_: 1b9o A:

Lineage for d1b9oa_ (1b9o A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Human (Homo sapiens) [TaxId:9606] [53977] (3 PDB entries)

8. Domain d1b9oa_: 1b9o A: [36597]
   complexed with ca

Details for d1b9oa_

PDB Entry: 1b9o, 1.15 Å

PDB Description: human alpha-lactalbumin, low temperature form

SCOP Domain Sequences for d1b9oa_:

Sequence; same for both SEQRES and ATOM records:

>d1b9oa_ d.2.1.2 (A:) alpha-Lactalbumin {Human (Homo sapiens)}
kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivendesteyglfqisnklw
ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc
ekl

Timeline for d1b9oa_:

• d1b9oa_ first appeared (with stable ids) in SCOP 1.55
  
• d1b9oa_ appears in SCOP 1.69
  
• d1b9oa_ appears in SCOP 1.73
  
• d1b9oa_ appears in the current release, SCOPe 2.08