Lineage for d1alc__ (1alc -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) 
Protein alpha-Lactalbumin [53975] (5 species) 
Species Baboon (Papio cynocephalus) [53976] (1 PDB entry) 
Domain d1alc__: 1alc - [36596]
Details for d1alc__
PDB Entry: 1alc (more details), 1.7 Å
PDB Description: refined structure of baboon alpha-lactalbumin at 1.7 angstroms resolution. comparison with c-type lysozyme
SCOP Domain Sequences for d1alc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1alc__ d.2.1.2 (-) alpha-Lactalbumin {Baboon (Papio cynocephalus)}
kqftkcelsqnlydidgygrialpelictmfhtsgydtqaivendesteyglfqisnalw
ckssqspqsrnicditcdkflddditddimcakkildikgidywiahkalctekleqwlc
ek
SCOP Domain Coordinates for d1alc__:
Click to download the PDB-style file with coordinates for d1alc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1alc__:
- d1alc__ first appeared (with stable ids) in SCOP 1.55
- d1alc__ appears in SCOP 1.59
- d1alc__ appears in the current release, SCOPe 2.08, called d1alca_
View in 3D