Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries) |
Domain d6iczf_: 6icz f: [365952] Other proteins in same PDB: d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6iczi_, d6iczj_, d6iczk_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_ automated match to d4f7ui_ complexed with atp, gtp, ihp, mg, zn |
PDB Entry: 6icz (more details), 3 Å
SCOPe Domain Sequences for d6iczf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iczf_ b.38.1.0 (f:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlge vlircnnvlyirgv
Timeline for d6iczf_:
View in 3D Domains from other chains: (mouse over for more information) d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_ |