SCOPe 2.08: Domain d6iczf_: 6icz f:

Lineage for d6iczf_ (6icz f:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries)

8. Domain d6iczf_: 6icz f: [365952]
   Other proteins in same PDB: d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6iczi_, d6iczj_, d6iczk_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
   automated match to d4f7ui_
   complexed with atp, gtp, ihp, mg, zn

Details for d6iczf_

PDB Entry: 6icz, 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom

PDB Compounds: (f:) Small nuclear ribonucleoprotein F

SCOPe Domain Sequences for d6iczf_:

Sequence; same for both SEQRES and ATOM records:

>d6iczf_ b.38.1.0 (f:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlge
vlircnnvlyirgv

Timeline for d6iczf_:

• d6iczf_ first appeared in SCOPe 2.07