Lineage for d6iczc1 (6icz C:56-439)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872428Domain d6iczc1: 6icz C:56-439 [365947]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d3jb9b1
    complexed with atp, gtp, ihp, mg, zn

Details for d6iczc1

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6iczc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczc1 c.37.1.0 (C:56-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlhedkkyyptaeevygpevetivqeedtqpltepiikpvktkkftlmeqtlpvtvye
mdfladlmdnselirnvtlcghlhhgktcfvdclieqthpeirkrydqdlcytdilfteq
ergvgikstpvtvvlpdtkgksylfnimdtpghvnfsdevtaglrisdgvvlfidaaegv
mlnterlikhavqerlavtvcinkidrlilelklpptdayyklrhivdevnglismystd
enlilspllgnvcfsssqysicftlgsfakiyadtfgdinyqefakrlwgdiyfnpktrk
ftkkaptsssqrsfvefileplykilaqvvgdvdtslprtldelgihltkeelklnirpl
lrlvckkffgeftgfvdmcvqhip

SCOPe Domain Coordinates for d6iczc1:

Click to download the PDB-style file with coordinates for d6iczc1.
(The format of our PDB-style files is described here.)

Timeline for d6iczc1: