Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries) |
Domain d6id0l_: 6id0 l: [365940] Other proteins in same PDB: d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0i_, d6id0j_, d6id0k_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_ automated match to d4f7uh_ complexed with gtp, ihp, mg, zn |
PDB Entry: 6id0 (more details), 2.9 Å
SCOPe Domain Sequences for d6id0l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id0l_ b.38.1.0 (l:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvlddaeeihsktksrkq lgrimlkgdnitllqsvsn
Timeline for d6id0l_:
View in 3D Domains from other chains: (mouse over for more information) d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_ |