Lineage for d6iczb_ (6icz b:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2787103Protein automated matches [365881] (1 species)
    not a true protein
  7. 2787104Species Human (Homo sapiens) [TaxId:9606] [365882] (3 PDB entries)
  8. 2787109Domain d6iczb_: 6icz b: [365939]
    Other proteins in same PDB: d6icza_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d1d3bl_
    complexed with atp, gtp, ihp, mg, zn

Details for d6iczb_

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (b:) Small nuclear ribonucleoprotein-associated protein

SCOPe Domain Sequences for d6iczb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczb_ b.38.1.1 (b:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaeree
krvlglvllrgenlvsmtvegpppkd

SCOPe Domain Coordinates for d6iczb_:

Click to download the PDB-style file with coordinates for d6iczb_.
(The format of our PDB-style files is described here.)

Timeline for d6iczb_: