Lineage for d6id1a_ (6id1 a:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787534Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries)
  8. 2787541Domain d6id1a_: 6id1 a: [365925]
    Other proteins in same PDB: d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1i_, d6id1j_, d6id1k_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_
    automated match to d3jcmj_
    complexed with gtp, ihp, mg, zn

Details for d6id1a_

PDB Entry: 6id1 (more details), 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution
PDB Compounds: (a:) Small nuclear ribonucleoprotein Sm D3

SCOPe Domain Sequences for d6id1a_:

Sequence, based on SEQRES records: (download)

>d6id1a_ b.38.1.0 (a:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
irgskirflilpdmlknapmlks

Sequence, based on observed residues (ATOM records): (download)

>d6id1a_ b.38.1.0 (a:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
irgskirflilpdmlknmlks

SCOPe Domain Coordinates for d6id1a_:

Click to download the PDB-style file with coordinates for d6id1a_.
(The format of our PDB-style files is described here.)

Timeline for d6id1a_: