Lineage for d1lmca_ (1lmc A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714022Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 714086Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 714632Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)
  8. 714636Domain d1lmca_: 1lmc A: [36592]
    complexed with bul

Details for d1lmca_

PDB Entry: 1lmc (more details), 2 Å

PDB Description: the crystal structure of a complex between bulgecin, a bacterial metabolite, and lysozyme from the rainbow trout
PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d1lmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmca_ d.2.1.2 (A:) Lysozyme {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

SCOP Domain Coordinates for d1lmca_:

Click to download the PDB-style file with coordinates for d1lmca_.
(The format of our PDB-style files is described here.)

Timeline for d1lmca_: