Lineage for d1lmp__ (1lmp -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 129072Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 129073Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 129082Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 129130Protein Lysozyme [53961] (15 species)
  7. 129528Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)
  8. 129532Domain d1lmp__: 1lmp - [36591]

Details for d1lmp__

PDB Entry: 1lmp (more details), 2 Å

PDB Description: the crystal structures of three complexes between chitooligosaccharides and lysozyme from the rainbow trout

SCOP Domain Sequences for d1lmp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmp__ d.2.1.2 (-) Lysozyme {Rainbow trout (Oncorhynchus mykiss)}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

SCOP Domain Coordinates for d1lmp__:

Click to download the PDB-style file with coordinates for d1lmp__.
(The format of our PDB-style files is described here.)

Timeline for d1lmp__: