Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.4: U2A'-like [52068] (2 proteins) duplication: consists of 5-6 partly irregular repeats this is a repeat family; one repeat unit is 1a9n C:89-114 found in domain |
Protein automated matches [365867] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [365868] (3 PDB entries) |
Domain d6id1o_: 6id1 o: [365909] Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_ automated match to d1a9nc_ complexed with gtp, ihp, mg, zn |
PDB Entry: 6id1 (more details), 2.86 Å
SCOPe Domain Sequences for d6id1o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id1o_ c.10.2.4 (o:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp llrrlktllvnnnricrigegldqalpclteliltnnslvelgdldplaslksltylsil rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfk
Timeline for d6id1o_:
View in 3D Domains from other chains: (mouse over for more information) d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_ |