Lineage for d6id1o_ (6id1 o:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851781Family c.10.2.4: U2A'-like [52068] (2 proteins)
    duplication: consists of 5-6 partly irregular repeats
    this is a repeat family; one repeat unit is 1a9n C:89-114 found in domain
  6. 2851788Protein automated matches [365867] (1 species)
    not a true protein
  7. 2851789Species Human (Homo sapiens) [TaxId:9606] [365868] (3 PDB entries)
  8. 2851790Domain d6id1o_: 6id1 o: [365909]
    Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_
    automated match to d1a9nc_
    complexed with gtp, ihp, mg, zn

Details for d6id1o_

PDB Entry: 6id1 (more details), 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution
PDB Compounds: (o:) U2 small nuclear ribonucleoprotein A'

SCOPe Domain Sequences for d6id1o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id1o_ c.10.2.4 (o:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
llrrlktllvnnnricrigegldqalpclteliltnnslvelgdldplaslksltylsil
rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfk

SCOPe Domain Coordinates for d6id1o_:

Click to download the PDB-style file with coordinates for d6id1o_.
(The format of our PDB-style files is described here.)

Timeline for d6id1o_: