Lineage for d1lmna_ (1lmn A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1632263Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1632323Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1633183Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)
  8. 1633185Domain d1lmna_: 1lmn A: [36589]

Details for d1lmna_

PDB Entry: 1lmn (more details), 1.8 Å

PDB Description: the refined crystal structure of lysozyme from the rainbow trout (oncorhynchus mykiss)
PDB Compounds: (A:) rainbow trout lysozyme

SCOPe Domain Sequences for d1lmna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmna_ d.2.1.2 (A:) Lysozyme {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

SCOPe Domain Coordinates for d1lmna_:

Click to download the PDB-style file with coordinates for d1lmna_.
(The format of our PDB-style files is described here.)

Timeline for d1lmna_: