Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries) |
Domain d1lmna_: 1lmn A: [36589] |
PDB Entry: 1lmn (more details), 1.8 Å
SCOPe Domain Sequences for d1lmna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lmna_ d.2.1.2 (A:) Lysozyme {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]} kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl rsyvagcgv
Timeline for d1lmna_: