Class g: Small proteins [56992] (100 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.0: automated matches [191345] (1 protein) not a true family |
Protein automated matches [190242] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189860] (17 PDB entries) |
Domain d6iczq1: 6icz q:3-59 [365884] Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq2, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_ automated match to d3jb9s1 complexed with atp, gtp, ihp, mg, zn |
PDB Entry: 6icz (more details), 3 Å
SCOPe Domain Sequences for d6iczq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iczq1 g.44.1.0 (q:3-59) automated matches {Human (Homo sapiens) [TaxId: 9606]} licsisnevpehpcvspvsnhvyerrliekyiaengtdpinnqplseeqlidikvah
Timeline for d6iczq1:
View in 3D Domains from other chains: (mouse over for more information) d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_ |