SCOPe 2.08: Domain d6fmgb_: 6fmg B:

Lineage for d6fmgb_ (6fmg B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.0: automated matches [191356] (1 protein)
   not a true family

6. Protein automated matches [190395] (8 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [365766] (1 PDB entry)

8. Domain d6fmgb_: 6fmg B: [365866]
   automated match to d1vsqa_

Details for d6fmgb_

PDB Entry: 6fmg, 1.8 Å

PDB Description: structure of the mannose transporter iia domain from streptococcus pneumoniae

PDB Compounds: (B:) PTS system mannose-specific transporter subunit IIAB

SCOPe Domain Sequences for d6fmgb_:

Sequence; same for both SEQRES and ATOM records:

>d6fmgb_ c.54.1.0 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mgsigiiiashgefaagihqsgsmifgeqekvqvvtfmpnegpddlyakfnnavaafdae
devlvladlwsgspfnqasrvmgenperkfaiitglnlpmliqayterlmdaaagvekva
aniikeakdgikalpeelnp

Timeline for d6fmgb_:

• d6fmgb_ first appeared in SCOPe 2.07