SCOPe 2.08: Domain d6i5ca2: 6i5c A:246-439

Lineage for d6i5ca2 (6i5c A:246-439)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

Domain d6i5ca2: 6i5c A:246-439 [365861]
Other proteins in same PDB: d6i5ca1, d6i5cb1, d6i5cc1, d6i5cd1, d6i5ce_, d6i5cf1, d6i5cf2, d6i5cf3
automated match to d1tuba2
complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d6i5ca2

PDB Entry: 6i5c (more details), 2.95 Å

PDB Description: long wavelength native-sad phasing of tubulin-stathmin-ttl complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6i5ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i5ca2 d.79.2.1 (A:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d6i5ca2:

Click to download the PDB-style file with coordinates for d6i5ca2.
(The format of our PDB-style files is described here.)

Timeline for d6i5ca2: