Lineage for d1qqya_ (1qqy A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 129072Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 129073Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 129082Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 129130Protein Lysozyme [53961] (15 species)
  7. 129311Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (3 PDB entries)
  8. 129312Domain d1qqya_: 1qqy A: [36586]

Details for d1qqya_

PDB Entry: 1qqy (more details), 1.85 Å

PDB Description: x-ray crystal structure analysis of canine milk lysozyme (apo-type)

SCOP Domain Sequences for d1qqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqya_ d.2.1.2 (A:) Lysozyme {Dog (Canis familiaris), milk}
mkifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
lskylascnl

SCOP Domain Coordinates for d1qqya_:

Click to download the PDB-style file with coordinates for d1qqya_.
(The format of our PDB-style files is described here.)

Timeline for d1qqya_: