Lineage for d2eqla_ (2eql A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. Species Horse (Equus caballus), milk [TaxId:9796] [53970] (1 PDB entry)
  8. Domain d2eqla_: 2eql A: [36585]

Details for d2eqla_

PDB Entry: 2eql (more details), 2.5 Å

PDB Description: crystallographic studies of a calcium binding lysozyme from equine milk at 2.5 angstroms resolution
PDB Compounds: (A:) horse milk lysozyme

SCOPe Domain Sequences for d2eqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eqla_ d.2.1.2 (A:) Lysozyme {Horse (Equus caballus), milk [TaxId: 9796]}
kvfskcelahklkaqemdgfggyslanwvcmaeyesnfntrafngknangssdyglfqln
nkwwckdnkrsssnacnimcsklldenidddiscakrvvrdpkgmsawkawvkhckdkdl
seylascnl

SCOPe Domain Coordinates for d2eqla_ are not available.

Timeline for d2eqla_: