Lineage for d1bb4a_ (1bb4 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714022Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 714086Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 714393Species Human (Homo sapiens) [TaxId:9606] [53969] (205 PDB entries)
  8. 714620Domain d1bb4a_: 1bb4 A: [36583]

Details for d1bb4a_

PDB Entry: 1bb4 (more details), 2.23 Å

PDB Description: human lysozyme double mutant a96l, w109h
PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d1bb4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bb4a_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavaclkrvvrdpqgirahvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1bb4a_:

Click to download the PDB-style file with coordinates for d1bb4a_.
(The format of our PDB-style files is described here.)

Timeline for d1bb4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bb4b_