Lineage for d6fqib_ (6fqi B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913863Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2913899Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)
  8. 2914267Domain d6fqib_: 6fqi B: [365808]
    automated match to d4h8ja_
    complexed with ggl

Details for d6fqib_

PDB Entry: 6fqi (more details), 2.91 Å

PDB Description: glua2(flop) g724c ligand binding core dimer bound to l-glutamate (form b) at 2.91 angstrom resolution
PDB Compounds: (B:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d6fqib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fqib_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvcgnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgecgsg

SCOPe Domain Coordinates for d6fqib_:

Click to download the PDB-style file with coordinates for d6fqib_.
(The format of our PDB-style files is described here.)

Timeline for d6fqib_: