Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Bifidobacterium adolescentis [TaxId:367928] [365789] (1 PDB entry) |
Domain d6fmea2: 6fme A:435-504 [365790] Other proteins in same PDB: d6fmea1, d6fmea3, d6fmea4, d6fmeb1, d6fmeb3 automated match to d1r7aa1 complexed with gol |
PDB Entry: 6fme (more details), 1.51 Å
SCOPe Domain Sequences for d6fmea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fmea2 b.71.1.0 (A:435-504) automated matches {Bifidobacterium adolescentis [TaxId: 367928]} afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd dlianppvva
Timeline for d6fmea2: