Lineage for d6f77f_ (6f77 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897888Species Rhizobium meliloti [TaxId:266834] [260118] (3 PDB entries)
  8. 2897897Domain d6f77f_: 6f77 F: [365764]
    automated match to d1bjwa_
    complexed with plp

Details for d6f77f_

PDB Entry: 6f77 (more details), 1.79 Å

PDB Description: crystal structure of the prephenate aminotransferase from rhizobium meliloti
PDB Compounds: (F:) Aspartate aminotransferase A

SCOPe Domain Sequences for d6f77f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f77f_ c.67.1.0 (F:) automated matches {Rhizobium meliloti [TaxId: 266834]}
afladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrge
tkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvip
apywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaay
sheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvskay
amtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqgr
rdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegva
vvhgsafglgpnfrisyatsealleeacrriqrfcaacr

SCOPe Domain Coordinates for d6f77f_:

Click to download the PDB-style file with coordinates for d6f77f_.
(The format of our PDB-style files is described here.)

Timeline for d6f77f_: