Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Rhizobium meliloti [TaxId:266834] [260118] (3 PDB entries) |
Domain d6f77f_: 6f77 F: [365764] automated match to d1bjwa_ complexed with plp |
PDB Entry: 6f77 (more details), 1.79 Å
SCOPe Domain Sequences for d6f77f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f77f_ c.67.1.0 (F:) automated matches {Rhizobium meliloti [TaxId: 266834]} afladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrge tkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvip apywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaay sheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvskay amtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqgr rdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegva vvhgsafglgpnfrisyatsealleeacrriqrfcaacr
Timeline for d6f77f_: