Lineage for d1ckgb_ (1ckg B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595959Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 595960Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 595969Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 596021Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 596253Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)
  8. 596467Domain d1ckgb_: 1ckg B: [36575]
    mutant

Details for d1ckgb_

PDB Entry: 1ckg (more details), 2.2 Å

PDB Description: t52v mutant human lysozyme
PDB Compounds: (B:)

SCOP Domain Sequences for d1ckgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckgb_ d.2.1.2 (B:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrsvdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1ckgb_:

Click to download the PDB-style file with coordinates for d1ckgb_.
(The format of our PDB-style files is described here.)

Timeline for d1ckgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ckga_