SCOP 1.71: Domain d2meab_: 2mea B:

Lineage for d2meab_ (2mea B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)

8. Domain d2meab_: 2mea B: [36573]
   mutant

Details for d2meab_

PDB Entry: 2mea, 2.2 Å

PDB Description: changes in conformational stability of a series of mutant human lysozymes at constant positions

SCOP Domain Sequences for d2meab_:

Sequence; same for both SEQRES and ATOM records:

>d2meab_ d.2.1.2 (B:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygffqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d2meab_:

• d2meab_ first appeared (with stable ids) in SCOP 1.55
  
• d2meab_ appears in SCOP 1.69
  
• d2meab_ appears in SCOP 1.73
  
• d2meab_ appears in the current release, SCOPe 2.08