Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Edwardsiella tarda [TaxId:498217] [365696] (2 PDB entries) |
Domain d5zf2a_: 5zf2 A: [365697] automated match to d4ruva_ complexed with so4 |
PDB Entry: 5zf2 (more details), 1.98 Å
SCOPe Domain Sequences for d5zf2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zf2a_ c.47.1.0 (A:) automated matches {Edwardsiella tarda [TaxId: 498217]} svepysdaaftqaqasgapvlvdvyadwcpvckrqereltplfaqpaqrdlrvfkvnfdt qkaalqqfrvsqqstlilyrngqevrrsigetspsalsdfltr
Timeline for d5zf2a_: