Lineage for d5zhib_ (5zhi B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921288Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. 2921301Protein automated matches [196235] (4 species)
    not a true protein
  7. 2921342Species Mycobacterium tuberculosis [TaxId:83331] [365694] (2 PDB entries)
  8. 2921344Domain d5zhib_: 5zhi B: [365695]
    automated match to d1oy5a_

Details for d5zhib_

PDB Entry: 5zhi (more details), 2.2 Å

PDB Description: apo crystal structure of trmd from mycobacterium tuberculosis
PDB Compounds: (B:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d5zhib_:

Sequence, based on SEQRES records: (download)

>d5zhib_ c.116.1.4 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
daarrmrveevsigdyvlpggesaavvmveavlrllagvlgnpashqddshstgldglle
gpsytrpaswrgldvpevllsgdhariaawrrevslqrtrerrpdl

Sequence, based on observed residues (ATOM records): (download)

>d5zhib_ c.116.1.4 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
daarrmrveevsigdyvlpggesaavvmveavlrllagvlgngllegpsytrpaswrgld
vpevllsgdhariaawrrevslqrtrerrpdl

SCOPe Domain Coordinates for d5zhib_:

Click to download the PDB-style file with coordinates for d5zhib_.
(The format of our PDB-style files is described here.)

Timeline for d5zhib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5zhia_