Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Scheffersomyces stipitis [TaxId:322104] [328836] (4 PDB entries) |
Domain d5ywna_: 5ywn A: [365686] automated match to d5gmoa_ complexed with nap |
PDB Entry: 5ywn (more details), 2.04 Å
SCOPe Domain Sequences for d5ywna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ywna_ c.2.1.0 (A:) automated matches {Scheffersomyces stipitis [TaxId: 322104]} mttsvfvsgatgylaqqiialvlskgykvvgsvrseekganlkklygddfsyevvkvleq kgafdealkkhpevtiflhtaspvtfevedtekeilipaingtkyvlqsikdvapqitrv vytssvvamsvpeelgspdvvlseaswsslsyeqskthgvlayfgskqfaeraawefveq ekpnfalstvnpvyifgpqakdeevkgtlnhsaemvnsvlklnkdddvpattgtfidvrd vakahlaafekdeakgerlllsntrfngqtlldvvrknfpqladklpvgkphsddfsafk ewndkktkkilgfeyfdfetsvvdsikqvlkvq
Timeline for d5ywna_: