Lineage for d5ywna_ (5ywn A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848446Species Scheffersomyces stipitis [TaxId:322104] [328836] (4 PDB entries)
  8. 2848447Domain d5ywna_: 5ywn A: [365686]
    automated match to d5gmoa_
    complexed with nap

Details for d5ywna_

PDB Entry: 5ywn (more details), 2.04 Å

PDB Description: sscr_l211h-nadp+
PDB Compounds: (A:) Protein induced by osmotic stress

SCOPe Domain Sequences for d5ywna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ywna_ c.2.1.0 (A:) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
mttsvfvsgatgylaqqiialvlskgykvvgsvrseekganlkklygddfsyevvkvleq
kgafdealkkhpevtiflhtaspvtfevedtekeilipaingtkyvlqsikdvapqitrv
vytssvvamsvpeelgspdvvlseaswsslsyeqskthgvlayfgskqfaeraawefveq
ekpnfalstvnpvyifgpqakdeevkgtlnhsaemvnsvlklnkdddvpattgtfidvrd
vakahlaafekdeakgerlllsntrfngqtlldvvrknfpqladklpvgkphsddfsafk
ewndkktkkilgfeyfdfetsvvdsikqvlkvq

SCOPe Domain Coordinates for d5ywna_:

Click to download the PDB-style file with coordinates for d5ywna_.
(The format of our PDB-style files is described here.)

Timeline for d5ywna_: