Lineage for d6nblc_ (6nbl C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503073Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2503074Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2503075Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2503127Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (20 PDB entries)
  8. 3065588Domain d6nblc_: 6nbl C: [365650]
    Other proteins in same PDB: d6nbla_, d6nblb_, d6nbld2
    automated match to d4jx1c_
    complexed with 1n0, ca, cam, cyn, fes, hem

Details for d6nblc_

PDB Entry: 6nbl (more details), 2.15 Å

PDB Description: cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide
PDB Compounds: (C:) putidaredoxin

SCOPe Domain Sequences for d6nblc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nblc_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw

SCOPe Domain Coordinates for d6nblc_:

Click to download the PDB-style file with coordinates for d6nblc_.
(The format of our PDB-style files is described here.)

Timeline for d6nblc_:

  • d6nblc_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-07