Lineage for d6nbla_ (6nbl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2331534Protein automated matches [190068] (10 species)
    not a true protein
  7. 2331641Species Pseudomonas putida [TaxId:303] [186787] (7 PDB entries)
  8. 3065584Domain d6nbla_: 6nbl A: [365646]
    Other proteins in same PDB: d6nblc_, d6nbld1, d6nbld2
    automated match to d4kkyx_
    complexed with 1n0, ca, cam, cyn, fes, hem

Details for d6nbla_

PDB Entry: 6nbl (more details), 2.15 Å

PDB Description: cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide
PDB Compounds: (A:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d6nbla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nbla_ a.104.1.1 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d6nbla_:

Click to download the PDB-style file with coordinates for d6nbla_.
(The format of our PDB-style files is described here.)

Timeline for d6nbla_:

  • d6nbla_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-07