Lineage for d1b5va_ (1b5v A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (13 species) 
Species Human (Homo sapiens) [TaxId:9606] [53969] (164 PDB entries) 
Domain d1b5va_: 1b5v A: [36563]
Details for d1b5va_
PDB Entry: 1b5v (more details), 2.17 Å
PDB Description: contribution of hydrogen bonds to the conformational stability of human lysozyme: calorimetry and x-ray analysis of six ser->ala mutants
SCOP Domain Sequences for d1b5va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b5va_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdratdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv
SCOP Domain Coordinates for d1b5va_:
Click to download the PDB-style file with coordinates for d1b5va_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b5va_:
- d1b5va_ appears in SCOP 1.57
- d1b5va_ appears in the current release, SCOPe 2.08
View in 3D