Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) |
Protein CMP acylneuraminate synthetase [53456] (2 species) a sialic acid activating synthetase |
Species Neisseria meningitidis [TaxId:487] [53457] (6 PDB entries) |
Domain d6cklc_: 6ckl C: [365608] automated match to d1eyra_ complexed with c5p, cl, dan, flc |
PDB Entry: 6ckl (more details), 2.68 Å
SCOPe Domain Sequences for d6cklc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cklc_ c.68.1.13 (C:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi ndtaslianncffiaptklyimshqdsididteldlqqaenilnh
Timeline for d6cklc_: