Lineage for d6cklc_ (6ckl C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898986Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2899023Protein CMP acylneuraminate synthetase [53456] (2 species)
    a sialic acid activating synthetase
  7. 2899029Species Neisseria meningitidis [TaxId:487] [53457] (6 PDB entries)
  8. 2899040Domain d6cklc_: 6ckl C: [365608]
    automated match to d1eyra_
    complexed with c5p, cl, dan, flc

Details for d6cklc_

PDB Entry: 6ckl (more details), 2.68 Å

PDB Description: n. meningitidis cmp-sialic acid synthetase in the presence of cmp and neu5ac2en
PDB Compounds: (C:) N-acylneuraminate cytidylyltransferase

SCOPe Domain Sequences for d6cklc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cklc_ c.68.1.13 (C:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]}
mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
ndtaslianncffiaptklyimshqdsididteldlqqaenilnh

SCOPe Domain Coordinates for d6cklc_:

Click to download the PDB-style file with coordinates for d6cklc_.
(The format of our PDB-style files is described here.)

Timeline for d6cklc_: