Lineage for d1b5wa_ (1b5w A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 129072Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 129073Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 129082Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 129130Protein Lysozyme [53961] (15 species)
  7. 129322Species Human (Homo sapiens) [TaxId:9606] [53969] (181 PDB entries)
  8. 129491Domain d1b5wa_: 1b5w A: [36557]

Details for d1b5wa_

PDB Entry: 1b5w (more details), 2.17 Å

PDB Description: contribution of hydrogen bonds to the conformational stability of human lysozyme: calorimetry and x-ray analysis of six ser->ala mutants
PDB Compounds: (A:)

SCOP Domain Sequences for d1b5wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5wa_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
arywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1b5wa_:

Click to download the PDB-style file with coordinates for d1b5wa_.
(The format of our PDB-style files is described here.)

Timeline for d1b5wa_: