SCOPe 2.08: Domain d6h5tb1: 6h5t B:741-803

Lineage for d6h5tb1 (6h5t B:741-803)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)

8. Domain d6h5tb1: 6h5t B:741-803 [365532]
   Other proteins in same PDB: d6h5ta2, d6h5tb2
   automated match to d2j6ka_
   complexed with 7pg, act, cl, zn

Details for d6h5tb1

PDB Entry: 6h5t, 1.69 Å

PDB Description: intersectin sh3a short isoform

PDB Compounds: (B:) Intersectin-1

SCOPe Domain Sequences for d6h5tb1:

Sequence; same for both SEQRES and ATOM records:

>d6h5tb1 b.34.2.0 (B:741-803) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvvyyralypfesrshdeitiqpgdivmvdesqtgepgwlggelkgktgwfpanyaekip
ene

Timeline for d6h5tb1:

• d6h5tb1 first appeared in SCOPe 2.07