Lineage for d1bb5a_ (1bb5 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 497065Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 497066Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 497075Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 497127Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 497356Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)
  8. 497543Domain d1bb5a_: 1bb5 A: [36553]

Details for d1bb5a_

PDB Entry: 1bb5 (more details), 1.8 Å

PDB Description: human lysozyme mutant a96l complexed with chitotriose

SCOP Domain Sequences for d1bb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bb5a_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavaclkrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1bb5a_:

Click to download the PDB-style file with coordinates for d1bb5a_.
(The format of our PDB-style files is described here.)

Timeline for d1bb5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bb5b_