SCOPe 2.08: Domain d6qh4c1: 6qh4 C:45-176

Lineage for d6qh4c1 (6qh4 C:45-176)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189952] (2 PDB entries)

8. Domain d6qh4c1: 6qh4 C:45-176 [365503]
   Other proteins in same PDB: d6qh4a2, d6qh4b2, d6qh4c2, d6qh4d2
   automated match to d4mtsa_
   complexed with co

Details for d6qh4c1

PDB Entry: 6qh4, 1.92 Å

PDB Description: crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant

PDB Compounds: (C:) Methylmalonyl-CoA epimerase, mitochondrial

SCOPe Domain Sequences for d6qh4c1:

Sequence, based on SEQRES records:

>d6qh4c1 d.32.1.0 (C:45-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgrlnhvaiavpdlekaaafyknilgaqvseavplpehgvsvvfvnlgntkmellhplgl
dspiagflqknkaggmhhicievdninaavmdlkkkkicslseevkigahgkpviflhpk
dcggvlveleqa

Sequence, based on observed residues (ATOM records):

>d6qh4c1 d.32.1.0 (C:45-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgrlnhvaiavpdlekaaafyknilgaqvseavplpehgvsvvfvnlgntkmellhplgl
dspiagflqknkaggmhhicievdninaavmdlkkkkicslsvkigahgkpviflhpkdc
ggvlveleqa

Timeline for d6qh4c1:

• d6qh4c1 first appeared in SCOPe 2.07