Lineage for d1di3a_ (1di3 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1190374Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1190375Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1190400Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
  6. 1190460Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1190789Species Human (Homo sapiens) [TaxId:9606] [53969] (208 PDB entries)
    Uniprot P00695
  8. 1190955Domain d1di3a_: 1di3 A: [36546]
    complexed with na

Details for d1di3a_

PDB Entry: 1di3 (more details), 1.8 Å

PDB Description: role of amino acid residues at turns in the conformational stability and folding of human lysozyme
PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d1di3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1di3a_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdgstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d1di3a_:

Click to download the PDB-style file with coordinates for d1di3a_.
(The format of our PDB-style files is described here.)

Timeline for d1di3a_: