Lineage for d6nnjv_ (6nnj V:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (228 PDB entries)
  8. 3065393Domain d6nnjv_: 6nnj V: [365455]
    Other proteins in same PDB: d6nnjd_, d6nnje_, d6nnjl1, d6nnjl2, d6nnju_
    automated match to d2q20b_
    complexed with bma, man, nag

Details for d6nnjv_

PDB Entry: 6nnj (more details), 2.6 Å

PDB Description: crystal structure of hiv-1 bg505 sosip.664 prefusion env trimer bound to ch31 scfv in complex with crystallization chaperones 3h109l fab and 35o22 scfv at 3.1 angstrom
PDB Compounds: (V:) CH31 scFv light chain

SCOPe Domain Sequences for d6nnjv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nnjv_ b.1.1.1 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsaslgdrvtitcqasrgigkdlnwyqqkagkapkllvsdastleggvps
rfsgsgfhqnfsltisslqaedvatyfcqqyetfgqgtkvd

SCOPe Domain Coordinates for d6nnjv_:

Click to download the PDB-style file with coordinates for d6nnjv_.
(The format of our PDB-style files is described here.)

Timeline for d6nnjv_: