SCOPe 2.08: Domain d6ildb1: 6ild B:72-216

Lineage for d6ildb1 (6ild B:72-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)

8. Domain d6ildb1: 6ild B:72-216 [365448]
   Other proteins in same PDB: d6ilda2, d6ildb2
   automated match to d3bjua1
   protein/RNA complex; complexed with 45a, gol, lys, mg

Details for d6ildb1

PDB Entry: 6ild, 1.88 Å

PDB Description: crystal structure of human lysrs: p38/aimp2 complex ii

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6ildb1:

Sequence; same for both SEQRES and ATOM records:

>d6ildb1 b.40.4.0 (B:72-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
kkgelsiipyeitllspclhmlphl

Timeline for d6ildb1:

• d6ildb1 first appeared in SCOPe 2.07