Lineage for d6nnju_ (6nnj U:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1236 PDB entries)
  8. 3065369Domain d6nnju_: 6nnj U: [365431]
    Other proteins in same PDB: d6nnjl2, d6nnjv_
    automated match to d5c2bh_
    complexed with bma, man, nag

Details for d6nnju_

PDB Entry: 6nnj (more details), 2.6 Å

PDB Description: crystal structure of hiv-1 bg505 sosip.664 prefusion env trimer bound to ch31 scfv in complex with crystallization chaperones 3h109l fab and 35o22 scfv at 3.1 angstrom
PDB Compounds: (U:) CH31 scFv heavy chain

SCOPe Domain Sequences for d6nnju_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nnju_ b.1.1.0 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaavrkpgasvtvsckfaedddyspywvnpapehfihflrqapgqqlewlawmn
ptngavnyawylngrvtatrdrsmttaflevkslrsddtavyycaraqkrgrsewayahw
gqgtpvvvs

SCOPe Domain Coordinates for d6nnju_:

Click to download the PDB-style file with coordinates for d6nnju_.
(The format of our PDB-style files is described here.)

Timeline for d6nnju_:

  • d6nnju_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-28