SCOPe 2.08: Domain d6j7ca1: 6j7c A:2-331

Lineage for d6j7ca1 (6j7c A:2-331)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Thermococcus litoralis [TaxId:523849] [365392] (3 PDB entries)

8. Domain d6j7ca1: 6j7c A:2-331 [365393]
   Other proteins in same PDB: d6j7ca2
   automated match to d1w61a_
   complexed with pro

Details for d6j7ca1

PDB Entry: 6j7c, 2.7 Å

PDB Description: crystal structure of proline racemase-like protein from thermococcus litoralis in complex with proline

PDB Compounds: (A:) proline racemase

SCOPe Domain Sequences for d6j7ca1:

Sequence; same for both SEQRES and ATOM records:

>d6j7ca1 d.21.1.0 (A:2-331) automated matches {Thermococcus litoralis [TaxId: 523849]}
fadhvfhvvdthtegeptrivlsgvnvkgediiekreyfkehydwirtallheprghsdq
fgavlvpsdiadfgviymdtsgyldmcghatmgvatvlvelgiiekkepyttvkletpag
lveakakvkggvvkevtvvdvpsfyvgefvieypgrgkikvdvafggnfyviadardlgl
rvrreyikeliptalklikvaneqikvqhprkgvqnrinlamltdeperedsdgknvviw
gegsvdrspcgtgsasrvatlyskgilkegdifvhesilgtqfrikivgttkigeytaii
peitgsayitkisqdiiskndplwkgfllr

Timeline for d6j7ca1:

• d6j7ca1 first appeared in SCOPe 2.07