Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (18 species) not a true protein |
Species Thermococcus litoralis [TaxId:523849] [365392] (3 PDB entries) |
Domain d6j7ca1: 6j7c A:2-331 [365393] Other proteins in same PDB: d6j7ca2 automated match to d1w61a_ complexed with pro |
PDB Entry: 6j7c (more details), 2.7 Å
SCOPe Domain Sequences for d6j7ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j7ca1 d.21.1.0 (A:2-331) automated matches {Thermococcus litoralis [TaxId: 523849]} fadhvfhvvdthtegeptrivlsgvnvkgediiekreyfkehydwirtallheprghsdq fgavlvpsdiadfgviymdtsgyldmcghatmgvatvlvelgiiekkepyttvkletpag lveakakvkggvvkevtvvdvpsfyvgefvieypgrgkikvdvafggnfyviadardlgl rvrreyikeliptalklikvaneqikvqhprkgvqnrinlamltdeperedsdgknvviw gegsvdrspcgtgsasrvatlyskgilkegdifvhesilgtqfrikivgttkigeytaii peitgsayitkisqdiiskndplwkgfllr
Timeline for d6j7ca1: