Lineage for d6j7ca1 (6j7c A:2-331)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508201Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2508202Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2508316Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2508317Protein automated matches [190491] (17 species)
    not a true protein
  7. 3065330Species Thermococcus litoralis [TaxId:523849] [365392] (1 PDB entry)
  8. 3065331Domain d6j7ca1: 6j7c A:2-331 [365393]
    Other proteins in same PDB: d6j7ca2
    automated match to d1w61a_
    complexed with pro

Details for d6j7ca1

PDB Entry: 6j7c (more details), 2.7 Å

PDB Description: crystal structure of proline racemase-like protein from thermococcus litoralis in complex with proline
PDB Compounds: (A:) proline racemase

SCOPe Domain Sequences for d6j7ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j7ca1 d.21.1.0 (A:2-331) automated matches {Thermococcus litoralis [TaxId: 523849]}
fadhvfhvvdthtegeptrivlsgvnvkgediiekreyfkehydwirtallheprghsdq
fgavlvpsdiadfgviymdtsgyldmcghatmgvatvlvelgiiekkepyttvkletpag
lveakakvkggvvkevtvvdvpsfyvgefvieypgrgkikvdvafggnfyviadardlgl
rvrreyikeliptalklikvaneqikvqhprkgvqnrinlamltdeperedsdgknvviw
gegsvdrspcgtgsasrvatlyskgilkegdifvhesilgtqfrikivgttkigeytaii
peitgsayitkisqdiiskndplwkgfllr

SCOPe Domain Coordinates for d6j7ca1:

Click to download the PDB-style file with coordinates for d6j7ca1.
(The format of our PDB-style files is described here.)

Timeline for d6j7ca1:

  • d6j7ca1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-28

View in 3D
Domains from same chain:
(mouse over for more information)
d6j7ca2