Lineage for d6h5ta1 (6h5t A:741-801)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377486Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2377487Protein automated matches [190457] (10 species)
    not a true protein
  7. 2377559Species Human (Homo sapiens) [TaxId:9606] [187598] (97 PDB entries)
  8. 3065310Domain d6h5ta1: 6h5t A:741-801 [365372]
    Other proteins in same PDB: d6h5ta2, d6h5tb2
    automated match to d2j6ka_
    complexed with 7pg, act, cl, zn

Details for d6h5ta1

PDB Entry: 6h5t (more details), 1.69 Å

PDB Description: intersectin sh3a short isoform
PDB Compounds: (A:) Intersectin-1

SCOPe Domain Sequences for d6h5ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h5ta1 b.34.2.0 (A:741-801) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvvyyralypfesrshdeitiqpgdivmvdesqtgepgwlggelkgktgwfpanyaekip
e

SCOPe Domain Coordinates for d6h5ta1:

Click to download the PDB-style file with coordinates for d6h5ta1.
(The format of our PDB-style files is described here.)

Timeline for d6h5ta1:

  • d6h5ta1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-28

View in 3D
Domains from same chain:
(mouse over for more information)
d6h5ta2