Lineage for d6ilhb2 (6ilh B:222-575)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532945Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2532946Protein automated matches [226887] (17 species)
    not a true protein
  7. 2532983Species Human (Homo sapiens) [TaxId:9606] [225403] (11 PDB entries)
  8. 3065292Domain d6ilhb2: 6ilh B:222-575 [365354]
    Other proteins in same PDB: d6ilha1, d6ilhb1
    automated match to d3bjua2
    complexed with kaa; mutant

Details for d6ilhb2

PDB Entry: 6ilh (more details), 2.5 Å

PDB Description: crystal structure of human lysyl-trna synthetase l350h mutant
PDB Compounds: (B:) Lysine-tRNA ligase

SCOPe Domain Sequences for d6ilhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ilhb2 d.104.1.0 (B:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdhmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

SCOPe Domain Coordinates for d6ilhb2:

Click to download the PDB-style file with coordinates for d6ilhb2.
(The format of our PDB-style files is described here.)

Timeline for d6ilhb2:

  • d6ilhb2 appears in periodic updates to SCOPe 2.07 starting on 2019-02-28

View in 3D
Domains from same chain:
(mouse over for more information)
d6ilhb1